PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA58G00004
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 315aa    MW: 36487.1 Da    PI: 5.2437
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA58G00004genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding506.9e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rgrWT+eEd++l  +++  G g+W++ +++ g+ R++k+c++rw +yl
       AA58G00004 14 RGRWTAEEDKILTTYIQTNGEGSWRSLPKKAGLLRCGKSCRLRWINYL 61
                     8*******************************99************97 PP

2Myb_DNA-binding56.27.9e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T+eE++++v+++ +lG++ W++Ia +++ gRt++++k++w+++l
       AA58G00004  67 RGNITAEEEDIIVKLHSLLGNR-WSLIATHLP-GRTDNEIKNYWNSHL 112
                      7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.402961IPR017930Myb domain
SuperFamilySSF466892.9E-2811108IPR009057Homeodomain-like
SMARTSM007175.8E-121363IPR001005SANT/Myb domain
PfamPF002495.0E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-221568IPR009057Homeodomain-like
CDDcd001671.38E-71661No hitNo description
PROSITE profilePS5129427.18762116IPR017930Myb domain
SMARTSM007176.1E-1766114IPR001005SANT/Myb domain
PfamPF002491.2E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-2569116IPR009057Homeodomain-like
CDDcd001672.27E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051555Biological Processflavonol biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MGRAPCCEKI GLKRGRWTAE EDKILTTYIQ TNGEGSWRSL PKKAGLLRCG KSCRLRWINY  60
LRRDLKRGNI TAEEEDIIVK LHSLLGNRWS LIATHLPGRT DNEIKNYWNS HLSRKIYAFT  120
TSVTEDKQNL IMDDLMNKNS SLLLETKNKI TKIKKKKKKG RTSRSSMKKH KKMVNETQYL  180
VEQENVINTE GQNGNLEGEC LEPYEWLDSE IERLMNSGEI GVKEIDLCDE EQGSETKFEC  240
VRLDDQNMNL EREIEESILS SNSNEIENKD WWVGLCSSDD LGFGIEEEWF NSDFRGGMTD  300
QNNLWDLSNI GEITF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-231211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00598PBMTransfer from AT5G49330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199744.11e-135myb domain protein 111
SwissprotO222647e-77MYB12_ARATH; Transcription factor MYB12
TrEMBLQ9FJ071e-135Q9FJ07_ARATH; MYB transcription factor
STRINGAT5G49330.11e-135(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.11e-118myb domain protein 111